PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 773aa    MW: 88129.7 Da    PI: 6.285
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618486.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK49.58.1e-16419464348
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                     + isledl++++ ++ ++AA +L+v++++ KriCR++GI+RWP  k
  XP_009618486.1 419 DMISLEDLQQNYGKKREEAAESLQVSVSTFKRICRKFGIDRWPTAK 464
                     679****************************************866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.957400490IPR003035RWP-RK domain
PfamPF020425.7E-16421467IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MCEQHKTLEF GTEEYNSNSN YGIPIPTQDV GFWQAECYSE IPAGSNFDIP SSSSNNLPGY  60
INFPANSTYN ENVEIIHDSF GKAAADQVVS RKLFCFANGH VLDPQRVDLF YLDLSKRAYQ  120
VTIHRHNGFD FFSLTKVVDV SDLFQLLKVF LSSKLRLMFL IDDEYSLLTD ELNLVVTGQP  180
HLQMEVKLAF SLQNLMRSTM HYAISQAYSS RMTKSQNVKS FVVCECENEL FLDHCRENSS  240
QSIQSFIPFG GNIKLSPCRV ASVVYSLYLY GEVQENFSIL GRVVDVSFSS VKFSYRTDPH  300
SSPGHSQDYH FHGILSLSLL VPTEQSPVEF FEIVYCPQRA HLTSKDQRSP GTNKQKQYGL  360
SPCLDSAVVQ SSSNERQMLL EAFEDDAIYS HESQEVVAES QTNIQKKRKK SSTMWTAADM  420
ISLEDLQQNY GKKREEAAES LQVSVSTFKR ICRKFGIDRW PTAKRNKDKC LFSARKCDAP  480
LIAKVRTSQL LQNGMPCEDR ETTCISRPKR KGKEKEAADN IEAINHFEEQ PSEIQNRTPK  540
RQAVDCATKD SSCLNSITGY VVDDMVSTRM GVQAYLEAIS IEQLNSISCN ENTSQNTKLL  600
FDNLIALPLK DLINPEKEIY MKETLCILAE NLSFFSVEQA KQIVELKFDF STLVHSWREY  660
SQSQVCSQKF FEDLERNRTL LATSAKDEES LKVRYDELQS KKKELMAQFE VVQKEQEGIA  720
EQRREKTEQK KHLVSLAKEK ASRTKEKQLV MTIASAKLNN LVDQWAAIQS LFM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405409KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618486.10.0PREDICTED: uncharacterized protein LOC104110657 isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.13e-11Nin-like family protein